PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G10060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 189aa    MW: 21598.5 Da    PI: 9.775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G10060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.6e-142061345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +WT+eEd  l ++ k+ G ++W+++ar m+ +R++  c++rw+
  LPERR07G10060.1 20 AWTAEEDATLQRLAKENGFRHWSRVARSMP-RRSARACRDRWR 61
                     7*****************************.***********8 PP

2Myb_DNA-binding22.13.6e-0772115348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T+ +d+ l++++ +lG + Wk I r +  gRt    k rw+ ++
  LPERR07G10060.1  72 PFTARDDDELLRLHYRLGDR-WKDIGRAVY-GRTSRVMKRRWRELR 115
                      79****************99.********9.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8371368IPR017930Myb domain
SMARTSM007172.0E-91766IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-2218111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-172073IPR009057Homeodomain-like
CDDcd001674.26E-122061No hitNo description
PfamPF139217.9E-132180No hitNo description
PROSITE profilePS500907.13165115IPR017877Myb-like domain
SMARTSM007170.001969117IPR001005SANT/Myb domain
CDDcd001678.18E-472114No hitNo description
Gene3DG3DSA:1.10.10.603.2E-874114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MATQPAARTR CVVRIRVPPA WTAEEDATLQ RLAKENGFRH WSRVARSMPR RSARACRDRW  60
RHDLARDVYD RPFTARDDDE LLRLHYRLGD RWKDIGRAVY GRTSRVMKRR WRELRRSGFP  120
ASAAGCRVEQ HAVDMESDQE EKAESVTREL ERPVADVLAS SFASCSIASD CAMDPFAGSL  180
ALGFACMAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_J2e-1522111695MYB3
3zqc_G2e-1522111695MYB3
3zqc_D2e-1522111695MYB3
3zqc_A2e-1522111695MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.18e-93PREDICTED: myb-related protein B-like
TrEMBLA0A0D9WY471e-134A0A0D9WY47_9ORYZ; Uncharacterized protein
STRINGBGIOSGA024398-PA2e-92(Oryza sativa Indica Group)
STRINGLOC_Os07g25370.12e-92(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-17myb domain protein 73